Lineage for d1bref_ (1bre F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756701Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 1756721Domain d1bref_: 1bre F: [20543]
    VL dimer of Bence-Jones protein BRE

Details for d1bref_

PDB Entry: 1bre (more details), 2 Å

PDB Description: immunoglobulin light chain protein
PDB Compounds: (F:) bence-jones kappa I protein bre

SCOPe Domain Sequences for d1bref_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bref_ b.1.1.1 (F:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

SCOPe Domain Coordinates for d1bref_:

Click to download the PDB-style file with coordinates for d1bref_.
(The format of our PDB-style files is described here.)

Timeline for d1bref_: