![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries) |
![]() | Domain d1bref_: 1bre F: [20543] |
PDB Entry: 1bre (more details), 2 Å
SCOP Domain Sequences for d1bref_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bref_ b.1.1.1 (F:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)} diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
Timeline for d1bref_: