SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p2ge2 (2p2g E:144-307)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139496Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2139497Protein automated matches [226938] (22 species)
    not a true protein
  7. 2139624Species Mycobacterium tuberculosis [TaxId:83332] [225288] (1 PDB entry)
  8. 2139634Domain d2p2ge2: 2p2g E:144-307 [205428]
    Other proteins in same PDB: d2p2ga3, d2p2gb3, d2p2gc3, d2p2gd3, d2p2ge3, d2p2gf3
    automated match to d1duvg2
    complexed with so4

Details for d2p2ge2

PDB Entry: 2p2g (more details), 2.7 Å

PDB Description: Crystal Structure of Ornithine Carbamoyltransferase from Mycobacterium Tuberculosis (Rv1656): Orthorhombic Form
PDB Compounds: (E:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d2p2ge2:

Sequence, based on SEQRES records: (download)

>d2p2ge2 c.78.1.0 (E:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga
svtvtadahaaaagadvlvtdtwtsmgqendgldrvkpfrpfqlnsrllaladsdaivlh
clpahrgdeitdavmdgpasavwdeaenrlhaqkallvwllers

Sequence, based on observed residues (ATOM records): (download)

>d2p2ge2 c.78.1.0 (E:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga
svtvtadahaaaagadvlvtdtwndgldrvkpfrpfqlnsrllaladsdaivlhclpahr
gdeitdavmdgpasavwdeaenrlhaqkallvwllers

SCOPe Domain Coordinates for d2p2ge2:

Click to download the PDB-style file with coordinates for d2p2ge2.
(The format of our PDB-style files is described here.)

Timeline for d2p2ge2: