![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries) |
![]() | Domain d2p2ge1: 2p2g E:2-143 [205427] Other proteins in same PDB: d2p2ga3, d2p2gb3, d2p2gc3, d2p2gd3, d2p2ge3, d2p2gf3 automated match to d1duvg1 complexed with so4 |
PDB Entry: 2p2g (more details), 2.7 Å
SCOPe Domain Sequences for d2p2ge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p2ge1 c.78.1.0 (E:2-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgi aqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvin alsdefhpcqvladlqtiaerk
Timeline for d2p2ge1: