SCOPe 2.05: Domain d2p2gc1: 2p2g C:1-143

Lineage for d2p2gc1 (2p2g C:1-143)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225288] (1 PDB entry)

8. Domain d2p2gc1: 2p2g C:1-143 [205423]
   automated match to d1duvg1
   complexed with so4

Details for d2p2gc1

PDB Entry: 2p2g, 2.7 Å

PDB Description: Crystal Structure of Ornithine Carbamoyltransferase from Mycobacterium Tuberculosis (Rv1656): Orthorhombic Form

PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d2p2gc1:

Sequence; same for both SEQRES and ATOM records:

>d2p2gc1 c.78.1.0 (C:1-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
virhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelg
iaqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvi
nalsdefhpcqvladlqtiaerk

Timeline for d2p2gc1:

• d2p2gc1 first appeared in SCOPe 2.03
  
• d2p2gc1 appears in SCOPe 2.04
  
• d2p2gc1 appears in SCOPe 2.06
  
• d2p2gc1 appears in the current release, SCOPe 2.08