Lineage for d2p2ga1 (2p2g A:2-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907015Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries)
  8. 2907136Domain d2p2ga1: 2p2g A:2-143 [205419]
    Other proteins in same PDB: d2p2ga3, d2p2gb3, d2p2gc3, d2p2gd3, d2p2ge3, d2p2gf3
    automated match to d1duvg1
    complexed with so4

Details for d2p2ga1

PDB Entry: 2p2g (more details), 2.7 Å

PDB Description: Crystal Structure of Ornithine Carbamoyltransferase from Mycobacterium Tuberculosis (Rv1656): Orthorhombic Form
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d2p2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p2ga1 c.78.1.0 (A:2-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgi
aqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvin
alsdefhpcqvladlqtiaerk

SCOPe Domain Coordinates for d2p2ga1:

Click to download the PDB-style file with coordinates for d2p2ga1.
(The format of our PDB-style files is described here.)

Timeline for d2p2ga1: