Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) |
Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins) automatically mapped to Pfam PF00710 |
Protein automated matches [190446] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [225264] (3 PDB entries) |
Domain d2p2db_: 2p2d B: [205416] automated match to d3ntxa_ complexed with gol |
PDB Entry: 2p2d (more details), 1.89 Å
SCOPe Domain Sequences for d2p2db_:
Sequence, based on SEQRES records: (download)
>d2p2db_ c.88.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} kksiyvaytggtigmqrseqgyipvsghlqrqlalmpefhrpempdftiheytplmdssd mtpedwqhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqipla elrsdgqinllnalyvaanypinevtlffnnrlyrgnrttkahadgfdafaspnlpplle agihirrlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsy gvgnapqnkaflqelqeasdrgivvvnltqcmsgkvnmggyatgnalahagviggadmtv eatltklhyllsqeldtetirkamsqnlrgeltpd
>d2p2db_ c.88.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} kksiyvaytggtigmqrseqgyipvsghlqrqlalmpefhrpempdftiheytplmdssd mtpedwqhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqipla elrsdgqinllnalyvaanypinevtlffnnrlyrgnrttkahadgfdafaspnlpplle agihirrlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsy gvgnapqnkaflqelqeasdrgivvvnltqcmsgkvnmnalahagviggadmtveatltk lhyllsqeldtetirkamsqnlrgeltpd
Timeline for d2p2db_: