Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d2p1ye2: 2p1y E:302-412 [205412] Other proteins in same PDB: d2p1ya1, d2p1yc1, d2p1ye1, d2p1yg1 automated match to d1bwma1 |
PDB Entry: 2p1y (more details), 2.42 Å
SCOPe Domain Sequences for d2p1ye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p1ye2 b.1.1.0 (E:302-412) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf tiffnkrekklslhiadsqpgdsatyfcaaidtnaykvifgkgthlhvlp
Timeline for d2p1ye2: