SCOPe 2.05: Domain d2p1pa2: 2p1p A:99-160

Lineage for d2p1pa2 (2p1p A:99-160)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.0: automated matches [227205] (1 protein)
   not a true family

6. Protein automated matches [226937] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (5 PDB entries)

8. Domain d2p1pa2: 2p1p A:99-160 [205410]
   Other proteins in same PDB: d2p1pa1
   automated match to d1p22b1
   complexed with iac, ihp

Details for d2p1pa2

PDB Entry: 2p1p, 2.21 Å

PDB Description: mechanism of auxin perception by the tir1 ubiquitin ligase

PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d2p1pa2:

Sequence; same for both SEQRES and ATOM records:

>d2p1pa2 a.157.1.0 (A:99-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
felilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwa
fe

Timeline for d2p1pa2:

• d2p1pa2 first appeared in SCOPe 2.03
  
• d2p1pa2 appears in SCOPe 2.04
  
• d2p1pa2 appears in SCOPe 2.06
  
• d2p1pa2 appears in the current release, SCOPe 2.08