| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
| Protein automated matches [190710] (5 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries) |
| Domain d2p1ma1: 2p1m A:8-58 [205407] Other proteins in same PDB: d2p1ma2 automated match to d2ovra2 complexed with ihp |
PDB Entry: 2p1m (more details), 1.8 Å
SCOPe Domain Sequences for d2p1ma1:
Sequence, based on SEQRES records: (download)
>d2p1ma1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakviey
>d2p1ma1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkseavalesqtiaplpnvtskilakviey
Timeline for d2p1ma1: