Lineage for d2p1ma1 (2p1m A:8-58)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411380Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1411381Protein automated matches [190710] (3 species)
    not a true protein
  7. 1411426Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (3 PDB entries)
  8. 1411427Domain d2p1ma1: 2p1m A:8-58 [205407]
    Other proteins in same PDB: d2p1ma2
    automated match to d2ovra2
    complexed with ihp

Details for d2p1ma1

PDB Entry: 2p1m (more details), 1.8 Å

PDB Description: tir1-ask1 complex structure
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d2p1ma1:

Sequence, based on SEQRES records: (download)

>d2p1ma1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakviey

Sequence, based on observed residues (ATOM records): (download)

>d2p1ma1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkseavalesqtiaplpnvtskilakviey

SCOPe Domain Coordinates for d2p1ma1:

Click to download the PDB-style file with coordinates for d2p1ma1.
(The format of our PDB-style files is described here.)

Timeline for d2p1ma1: