SCOPe 2.04: Domain d2p0ra_: 2p0r A:

Lineage for d2p0ra_ (2p0r A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
   automatically mapped to Pfam PF00648

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
   includes the N-terminal 'sequence' domain I

7. Species Human (Homo sapiens) [TaxId:9606] [225239] (1 PDB entry)

8. Domain d2p0ra_: 2p0r A: [205405]
   automated match to d1mdwa_
   complexed with ca

Details for d2p0ra_

PDB Entry: 2p0r, 2.5 Å

PDB Description: Structure of Human Calpain 9 in complex with Leupeptin

PDB Compounds: (A:) Calpain-9

SCOPe Domain Sequences for d2p0ra_:

Sequence; same for both SEQRES and ATOM records:

>d2p0ra_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens) [TaxId: 9606]}
arithssgqsfeqmrqeclqrgtlfedadfpasnsslfyserpqipfvwkrpgeivknpe
filggatrtdicqgelgdcwllaaiasltlnqkalarvipqdqsfgpgyagifhfqfwqh
sewldvviddrlptfrdrlvflhsadhnefwsallekayaklngsyealkggsaieamed
ftggvaetfqtkeapenfyeilekalkrgsllgcfidtrsaaeseartpfglikghaysv
tgidqvsfrgqrielirirnpwgqvewngswsdsspewrsvgpaeqkrlchtalddgefw
mafkdfkahfdkveicnlt

Timeline for d2p0ra_:

• d2p0ra_ first appeared in SCOPe 2.03
  
• d2p0ra_ appears in SCOPe 2.05
  
• d2p0ra_ appears in the current release, SCOPe 2.08