Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
Species Human (Homo sapiens) [TaxId:9606] [225239] (1 PDB entry) |
Domain d2p0ra_: 2p0r A: [205405] automated match to d1mdwa_ complexed with ca |
PDB Entry: 2p0r (more details), 2.5 Å
SCOPe Domain Sequences for d2p0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0ra_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens) [TaxId: 9606]} arithssgqsfeqmrqeclqrgtlfedadfpasnsslfyserpqipfvwkrpgeivknpe filggatrtdicqgelgdcwllaaiasltlnqkalarvipqdqsfgpgyagifhfqfwqh sewldvviddrlptfrdrlvflhsadhnefwsallekayaklngsyealkggsaieamed ftggvaetfqtkeapenfyeilekalkrgsllgcfidtrsaaeseartpfglikghaysv tgidqvsfrgqrielirirnpwgqvewngswsdsspewrsvgpaeqkrlchtalddgefw mafkdfkahfdkveicnlt
Timeline for d2p0ra_: