SCOPe 2.08: Domain d2oypa1: 2oyp A:24-131

Lineage for d2oypa1 (2oyp A:24-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2oypa1: 2oyp A:24-131 [205400]
   Other proteins in same PDB: d2oypa2
   automated match to d1py9a_
   complexed with so4

Details for d2oypa1

PDB Entry: 2oyp, 1.95 Å

PDB Description: t cell immunoglobulin mucin-3 crystal structure revealed a galectin-9- independent binding surface

PDB Compounds: (A:) Hepatitis A virus cellular receptor 2

SCOPe Domain Sequences for d2oypa1:

Sequence; same for both SEQRES and ATOM records:

>d2oypa1 b.1.1.0 (A:24-131) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssry
qlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik

Timeline for d2oypa1:

• d2oypa1 first appeared in SCOPe 2.03, called d2oypa_
  
• d2oypa1 appears in SCOPe 2.07