Lineage for d1brec_ (1bre C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287780Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (16 PDB entries)
  8. 287795Domain d1brec_: 1bre C: [20540]

Details for d1brec_

PDB Entry: 1bre (more details), 2 Å

PDB Description: immunoglobulin light chain protein

SCOP Domain Sequences for d1brec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brec_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

SCOP Domain Coordinates for d1brec_:

Click to download the PDB-style file with coordinates for d1brec_.
(The format of our PDB-style files is described here.)

Timeline for d1brec_: