SCOPe 2.06: Domain d2oxeb2: 2oxe B:356-469

Lineage for d2oxeb2 (2oxe B:356-469)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225245] (7 PDB entries)

8. Domain d2oxeb2: 2oxe B:356-469 [205399]
   Other proteins in same PDB: d2oxea1, d2oxeb1
   automated match to d1bu8a1
   complexed with ca, cl

Details for d2oxeb2

PDB Entry: 2oxe, 2.8 Å

PDB Description: structure of the human pancreatic lipase-related protein 2

PDB Compounds: (B:) Pancreatic lipase-related protein 2

SCOPe Domain Sequences for d2oxeb2:

Sequence, based on SEQRES records:

>d2oxeb2 b.12.1.0 (B:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnkrginlsepklgasqitvqsgedgteynfcssdtveenvlqslypc

Sequence, based on observed residues (ATOM records):

>d2oxeb2 b.12.1.0 (B:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnksepklgasqitvqsgedgteynfcssdtveenvlqslypc

Timeline for d2oxeb2:

• d2oxeb2 first appeared in SCOPe 2.03
  
• d2oxeb2 appears in SCOPe 2.05
  
• d2oxeb2 appears in SCOPe 2.07
  
• d2oxeb2 appears in the current release, SCOPe 2.08