![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
![]() | Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
![]() | Family b.12.1.0: automated matches [227174] (1 protein) not a true family |
![]() | Protein automated matches [226891] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries) |
![]() | Domain d2oxea2: 2oxe A:356-469 [205397] Other proteins in same PDB: d2oxea1, d2oxeb1 automated match to d1bu8a1 complexed with ca, cl |
PDB Entry: 2oxe (more details), 2.8 Å
SCOPe Domain Sequences for d2oxea2:
Sequence, based on SEQRES records: (download)
>d2oxea2 b.12.1.0 (A:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki qkvkflwnkrginlsepklgasqitvqsgedgteynfcssdtveenvlqslypc
>d2oxea2 b.12.1.0 (A:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki qkvkflwnkepklgasqitvqsgedgteynfcssdtveenvlqslypc
Timeline for d2oxea2: