SCOPe 2.08: Domain d2oxca_: 2oxc A:

Lineage for d2oxca_ (2oxc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d2oxca_: 2oxc A: [205394]
   automated match to d1t6na_
   protein/RNA complex; complexed with adp

Details for d2oxca_

PDB Entry: 2oxc, 1.3 Å

PDB Description: human dead-box rna helicase ddx20, dead domain in complex with adp

PDB Compounds: (A:) Probable ATP-dependent RNA helicase DDX20

SCOPe Domain Sequences for d2oxca_:

Sequence; same for both SEQRES and ATOM records:

>d2oxca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
vsatypeflanaltkymrdptfvrl

Timeline for d2oxca_:

• d2oxca_ first appeared in SCOPe 2.03
  
• d2oxca_ appears in SCOPe 2.07