Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Zymomonas mobilis [TaxId:542] [225233] (1 PDB entry) |
Domain d2ox4c2: 2ox4 C:119-392 [205383] Other proteins in same PDB: d2ox4a1, d2ox4a3, d2ox4b1, d2ox4b3, d2ox4c1, d2ox4c3, d2ox4c4, d2ox4d1, d2ox4d3, d2ox4d4, d2ox4e1, d2ox4e3, d2ox4f1, d2ox4f3, d2ox4g1, d2ox4g3, d2ox4h1, d2ox4h3 automated match to d2gl5a1 complexed with cl, gol, mg |
PDB Entry: 2ox4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ox4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox4c2 c.1.11.0 (C:119-392) automated matches {Zymomonas mobilis [TaxId: 542]} knredlrvyasqlqfgwgkerkskgrkeeyaeealkavaegydavkvdvlahdrngsreg vflegplpsetikigverveairnavgpdvdiivenhghtdlvsaiqfakaieefniffy eeintplnprllkeakkkidiplasgeriysrwgflpfledrsidviqpdlgtcggftef kkiadmahifevtvqahvagtgvaeaaslhaeiaipnfcihehhqktllpeyeelcvhny qpvkgrykvpelpgigqditeklyqisdyvsiea
Timeline for d2ox4c2: