| Root: SCOPe 2.05 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
| Family c.92.2.2: TroA-like [53811] (6 proteins) |
| Protein automated matches [191053] (3 species) not a true protein |
| Species Synechocystis sp. [TaxId:1143] [225291] (2 PDB entries) |
| Domain d2ov1a_: 2ov1 A: [205374] automated match to d1pq4a_ |
PDB Entry: 2ov1 (more details), 2.5 Å
SCOPe Domain Sequences for d2ov1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ov1a_ c.92.2.2 (A:) automated matches {Synechocystis sp. [TaxId: 1143]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplempgrlmvadphiwlsptlvkrqattiakel
aeldpdnrdqyeanlaaflaelerlnqelgqilqplpqrkfivfhpswayfardynlvqi
pievegqepsaqelkqlidtakennltmvfgetqfstksseaiaaeigagvelldplaad
wssnlkavaqkianansaqp
Timeline for d2ov1a_: