SCOPe 2.06: Domain d2oukd_: 2ouk D:

Lineage for d2oukd_ (2ouk D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)

8. Domain d2oukd_: 2ouk D: [205372]
   Other proteins in same PDB: d2ouka2, d2oukc2
   automated match to d1b0ua_
   complexed with so4

Details for d2oukd_

PDB Entry: 2ouk, 2.15 Å

PDB Description: abc protein artp in complex with sulphate

PDB Compounds: (D:) protein ArtP

SCOPe Domain Sequences for d2oukd_:

Sequence; same for both SEQRES and ATOM records:

>d2oukd_ c.37.1.0 (D:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
f

Timeline for d2oukd_:

• d2oukd_ first appeared in SCOPe 2.03
  
• d2oukd_ appears in SCOPe 2.05
  
• d2oukd_ appears in SCOPe 2.07
  
• d2oukd_ appears in the current release, SCOPe 2.08