SCOPe 2.04: Domain d2ouka_: 2ouk A:

Lineage for d2ouka_ (2ouk A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)

8. Domain d2ouka_: 2ouk A: [205369]
   automated match to d1b0ua_
   complexed with so4

Details for d2ouka_

PDB Entry: 2ouk, 2.15 Å

PDB Description: abc protein artp in complex with sulphate

PDB Compounds: (A:) protein ArtP

SCOPe Domain Sequences for d2ouka_:

Sequence; same for both SEQRES and ATOM records:

>d2ouka_ c.37.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

Timeline for d2ouka_:

• d2ouka_ first appeared in SCOPe 2.03
  
• d2ouka_ appears in SCOPe 2.05
  
• d2ouka_ appears in the current release, SCOPe 2.08, called d2ouka1