SCOPe 2.05: Domain d2ouda_: 2oud A:

Lineage for d2ouda_ (2oud A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (99 PDB entries)

8. Domain d2ouda_: 2oud A: [205368]
   automated match to d1zzwb_
   complexed with cl

Details for d2ouda_

PDB Entry: 2oud, 2.8 Å

PDB Description: crystal structure of the catalytic domain of human mkp5

PDB Compounds: (A:) Dual specificity protein phosphatase 10

SCOPe Domain Sequences for d2ouda_:

Sequence; same for both SEQRES and ATOM records:

>d2ouda_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdienaeltpilpflflgneqdaqdldtmqrlnigyvinvtthlplyhyekglfnykrlp
atdsnkqnlrqyfeeafefieeahqcgkgllihcqagvsrsativiaylmkhtrmtmtda
ykfvkgkrpiispnlnfmgqllefeedlnngvtpriltpklmgvetvvkeaaalehh

Timeline for d2ouda_:

• d2ouda_ first appeared in SCOPe 2.03
  
• d2ouda_ appears in SCOPe 2.04
  
• d2ouda_ is called d2ouda1 in SCOPe 2.06
  
• d2ouda_ appears in the current release, SCOPe 2.08, called d2ouda1