Lineage for d2otpb2 (2otp B:96-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754010Domain d2otpb2: 2otp B:96-196 [205367]
    Other proteins in same PDB: d2otpa1, d2otpb1
    automated match to d1g0xa2

Details for d2otpb2

PDB Entry: 2otp (more details), 2.6 Å

PDB Description: crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)
PDB Compounds: (B:) Leukocyte immunoglobulin-like receptor subfamily A member 2

SCOPe Domain Sequences for d2otpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otpb2 b.1.1.4 (B:96-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayskptlsalpspvvtlggnvtlqcvsqvafdgfilckegedehpqclnshshargwswa
ifsvgpvspsrrwsyrcyaydsnspyvwslpsdllellvpg

SCOPe Domain Coordinates for d2otpb2:

Click to download the PDB-style file with coordinates for d2otpb2.
(The format of our PDB-style files is described here.)

Timeline for d2otpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2otpb1