Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries) |
Domain d2otpa2: 2otp A:96-196 [205365] Other proteins in same PDB: d2otpa1, d2otpb1 automated match to d1g0xa2 |
PDB Entry: 2otp (more details), 2.6 Å
SCOPe Domain Sequences for d2otpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otpa2 b.1.1.4 (A:96-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} ayskptlsalpspvvtlggnvtlqcvsqvafdgfilckegedehpqclnshshargwswa ifsvgpvspsrrwsyrcyaydsnspyvwslpsdllellvpg
Timeline for d2otpa2: