SCOPe 2.03: Domain d2otpa2: 2otp A:96-196

Lineage for d2otpa2 (2otp A:96-196)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)

8. Domain d2otpa2: 2otp A:96-196 [205365]
   Other proteins in same PDB: d2otpa1, d2otpb1
   automated match to d1g0xa2

Details for d2otpa2

PDB Entry: 2otp, 2.6 Å

PDB Description: crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily A member 2

SCOPe Domain Sequences for d2otpa2:

Sequence; same for both SEQRES and ATOM records:

>d2otpa2 b.1.1.4 (A:96-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayskptlsalpspvvtlggnvtlqcvsqvafdgfilckegedehpqclnshshargwswa
ifsvgpvspsrrwsyrcyaydsnspyvwslpsdllellvpg

Timeline for d2otpa2:

• d2otpa2 is new in SCOPe 2.03-stable
  
• d2otpa2 appears in SCOPe 2.04
  
• d2otpa2 appears in the current release, SCOPe 2.08