SCOPe 2.08: Domain d2otpa1: 2otp A:3-95

Lineage for d2otpa1 (2otp A:3-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2otpa1: 2otp A:3-95 [205364]
   Other proteins in same PDB: d2otpa2, d2otpb2
   automated match to d1g0xa1

Details for d2otpa1

PDB Entry: 2otp, 2.6 Å

PDB Description: crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2)

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily A member 2

SCOPe Domain Sequences for d2otpa1:

Sequence, based on SEQRES records:

>d2otpa1 b.1.1.0 (A:3-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenksaswvrriqepgkngqfpip
sitwehagryhcqyyshnhsseysdplelvvtg

Sequence, based on observed residues (ATOM records):

>d2otpa1 b.1.1.0 (A:3-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenkaswvrriqepgkngqfpips
itwehagryhcqyyshnhsseysdplelvvtg

Timeline for d2otpa1:

• d2otpa1 first appeared in SCOPe 2.03
  
• d2otpa1 appears in SCOPe 2.07