SCOPe 2.05: Domain d2otdd_: 2otd D:

Lineage for d2otdd_ (2otd D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (10 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [225231] (1 PDB entry)

8. Domain d2otdd_: 2otd D: [205363]
   automated match to d2pz0a_
   complexed with po4

Details for d2otdd_

PDB Entry: 2otd, 2.6 Å

PDB Description: The crystal structure of the glycerophosphodiester phosphodiesterase from Shigella flexneri 2a

PDB Compounds: (D:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d2otdd_:

Sequence; same for both SEQRES and ATOM records:

>d2otdd_ c.1.18.0 (D:) automated matches {Shigella flexneri [TaxId: 623]}
snwpyprivahrgggklapentlaaidvgakyghkmiefdaklskdgeifllhddnlert
sngwgvagelnwqdllrvdagswyskafkgeplpllsqvaercrehgmmanieikpttgt
gpltgkmvalaarqlwagmtppllssfeidaleaaqqaapelprgllldewrddwrelta
rlgcvsihlnhklldkarvmqlkdaglrilvytvnkpqhaaellrwgvdcictdaidvig
pnfta

Timeline for d2otdd_:

• d2otdd_ first appeared in SCOPe 2.03
  
• d2otdd_ appears in SCOPe 2.04
  
• d2otdd_ appears in SCOPe 2.06
  
• d2otdd_ appears in the current release, SCOPe 2.08