Lineage for d2osaa_ (2osa A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338321Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2338322Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2338378Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2338379Protein automated matches [226932] (4 species)
    not a true protein
  7. 2338383Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)
  8. 2338391Domain d2osaa_: 2osa A: [205358]
    automated match to d1f7ca_

Details for d2osaa_

PDB Entry: 2osa (more details), 1.8 Å

PDB Description: the rho-gap domain of human n-chimaerin
PDB Compounds: (A:) N-chimaerin

SCOPe Domain Sequences for d2osaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2osaa_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvyscdlttlvkahttkrpmvvdmcireiesrglnseglyrvsgfsdliedvkmafdrdg
ekadisvnmyediniitgalklyfrdlpiplitydaypkfiesakimdpdeqletlheal
kllppahcetlrylmahlkrvtlhekenlmnaenlgivfgptlmrspeldamaalndiry
qrlvvelliknedilf

SCOPe Domain Coordinates for d2osaa_:

Click to download the PDB-style file with coordinates for d2osaa_.
(The format of our PDB-style files is described here.)

Timeline for d2osaa_: