![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries) |
![]() | Domain d2osaa_: 2osa A: [205358] automated match to d1f7ca_ |
PDB Entry: 2osa (more details), 1.8 Å
SCOPe Domain Sequences for d2osaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2osaa_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvyscdlttlvkahttkrpmvvdmcireiesrglnseglyrvsgfsdliedvkmafdrdg ekadisvnmyediniitgalklyfrdlpiplitydaypkfiesakimdpdeqletlheal kllppahcetlrylmahlkrvtlhekenlmnaenlgivfgptlmrspeldamaalndiry qrlvvelliknedilf
Timeline for d2osaa_: