SCOPe 2.07: Domain d2osaa_: 2osa A:

Lineage for d2osaa_ (2osa A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)

8. Domain d2osaa_: 2osa A: [205358]
   automated match to d1f7ca_

Details for d2osaa_

PDB Entry: 2osa, 1.8 Å

PDB Description: the rho-gap domain of human n-chimaerin

PDB Compounds: (A:) N-chimaerin

SCOPe Domain Sequences for d2osaa_:

Sequence; same for both SEQRES and ATOM records:

>d2osaa_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvyscdlttlvkahttkrpmvvdmcireiesrglnseglyrvsgfsdliedvkmafdrdg
ekadisvnmyediniitgalklyfrdlpiplitydaypkfiesakimdpdeqletlheal
kllppahcetlrylmahlkrvtlhekenlmnaenlgivfgptlmrspeldamaalndiry
qrlvvelliknedilf

Timeline for d2osaa_:

• d2osaa_ first appeared in SCOPe 2.03
  
• d2osaa_ appears in SCOPe 2.06
  
• d2osaa_ appears in the current release, SCOPe 2.08