Lineage for d2os1a1 (2os1 A:1-187)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606872Species Enterococcus faecalis [TaxId:1351] [225419] (2 PDB entries)
  8. 2606874Domain d2os1a1: 2os1 A:1-187 [205357]
    Other proteins in same PDB: d2os1a2
    automated match to d1vezb_
    complexed with bb2, ni, so4

Details for d2os1a1

PDB Entry: 2os1 (more details), 1.5 Å

PDB Description: Structures of actinonin bound peptide deformylases from E. faecalis and S. pyogenes
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2os1a1:

Sequence, based on SEQRES records: (download)

>d2os1a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]}
mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrggvg
laapqldiskriiavhvpsndpenetpslstvmynpkilshsvqdvclgegegclsvdrd
vpgyvvrhnkitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalk
egvlvie

Sequence, based on observed residues (ATOM records): (download)

>d2os1a1 d.167.1.1 (A:1-187) Peptide deformylase {Enterococcus faecalis [TaxId: 1351]}
mitmkdiiregnptlravaeevpvpiteedrqlgedmltflknsqdpvkaeelqlrggvg
laapqldiskriiavhvpslstvmynpkilshsvqdvclgegegclsvdrdvpgyvvrhn
kitvsyfdmagekhkvrlknyeaivvqheidhingimfydhinkenpfalkegvlvie

SCOPe Domain Coordinates for d2os1a1:

Click to download the PDB-style file with coordinates for d2os1a1.
(The format of our PDB-style files is described here.)

Timeline for d2os1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2os1a2