Lineage for d2ored_ (2ore D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130085Protein DNA methylase T4DAM [102584] (2 species)
  7. 2130102Species Escherichia coli [TaxId:562] [190028] (2 PDB entries)
  8. 2130105Domain d2ored_: 2ore D: [205353]
    automated match to d2g1pa_
    complexed with sah, so4

Details for d2ored_

PDB Entry: 2ore (more details), 2.99 Å

PDB Description: Binary Structure of Escherichia coli DNA Adenine Methyltransferase and S-adenosylhomocysteine
PDB Compounds: (D:) DNA adenine methylase

SCOPe Domain Sequences for d2ored_:

Sequence, based on SEQRES records: (download)

>d2ored_ c.66.1.28 (D:) DNA methylase T4DAM {Escherichia coli [TaxId: 562]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp
pyaplsatanftayhtnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqrakl
hvvkvrrsissnggtrkkvdellalykp

Sequence, based on observed residues (ATOM records): (download)

>d2ored_ c.66.1.28 (D:) DNA methylase T4DAM {Escherichia coli [TaxId: 562]}
knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl
ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl
crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp
pyaplnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkvdellal
ykp

SCOPe Domain Coordinates for d2ored_:

Click to download the PDB-style file with coordinates for d2ored_.
(The format of our PDB-style files is described here.)

Timeline for d2ored_: