Lineage for d2oqra2 (2oqr A:129-226)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260359Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1260445Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1260446Protein automated matches [190858] (9 species)
    not a true protein
  7. 1260466Species Mycobacterium tuberculosis [TaxId:83332] [225356] (2 PDB entries)
  8. 1260473Domain d2oqra2: 2oqr A:129-226 [205352]
    Other proteins in same PDB: d2oqra1
    automated match to d1p2fa1
    complexed with act, bme, la

Details for d2oqra2

PDB Entry: 2oqr (more details), 2.03 Å

PDB Description: the structure of the response regulator regx3 from mycobacterium tuberculosis
PDB Compounds: (A:) Sensory transduction protein regX3

SCOPe Domain Sequences for d2oqra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqra2 a.4.6.0 (A:129-226) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gvlesgpvrmdverhvvsvngdtitlplkefdlleylmrnsgrvltrgqlidrvwgadyv
gdtktldvhvkrlrskieadpanpvhlvtvrglgykle

SCOPe Domain Coordinates for d2oqra2:

Click to download the PDB-style file with coordinates for d2oqra2.
(The format of our PDB-style files is described here.)

Timeline for d2oqra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oqra1