![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (25 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225356] (2 PDB entries) |
![]() | Domain d2oqra2: 2oqr A:129-226 [205352] Other proteins in same PDB: d2oqra1, d2oqra3 automated match to d1p2fa1 complexed with act, bme, la |
PDB Entry: 2oqr (more details), 2.03 Å
SCOPe Domain Sequences for d2oqra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqra2 a.4.6.0 (A:129-226) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gvlesgpvrmdverhvvsvngdtitlplkefdlleylmrnsgrvltrgqlidrvwgadyv gdtktldvhvkrlrskieadpanpvhlvtvrglgykle
Timeline for d2oqra2: