Lineage for d2oqra1 (2oqr A:1-128)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356521Species Mycobacterium tuberculosis [TaxId:83332] [225355] (1 PDB entry)
  8. 1356522Domain d2oqra1: 2oqr A:1-128 [205351]
    Other proteins in same PDB: d2oqra2
    automated match to d1p2fa2
    complexed with act, bme, la

Details for d2oqra1

PDB Entry: 2oqr (more details), 2.03 Å

PDB Description: the structure of the response regulator regx3 from mycobacterium tuberculosis
PDB Compounds: (A:) Sensory transduction protein regX3

SCOPe Domain Sequences for d2oqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqra1 c.23.1.0 (A:1-128) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
atsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpgmsg
tdvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlrrgg
dddsemsd

SCOPe Domain Coordinates for d2oqra1:

Click to download the PDB-style file with coordinates for d2oqra1.
(The format of our PDB-style files is described here.)

Timeline for d2oqra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oqra2