![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225355] (1 PDB entry) |
![]() | Domain d2oqra1: 2oqr A:2-128 [205351] Other proteins in same PDB: d2oqra2, d2oqra3 automated match to d1p2fa2 complexed with act, bme, la |
PDB Entry: 2oqr (more details), 2.03 Å
SCOPe Domain Sequences for d2oqra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqra1 c.23.1.0 (A:2-128) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} tsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpgmsgt dvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlrrggd ddsemsd
Timeline for d2oqra1: