Lineage for d2oqra1 (2oqr A:2-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856035Species Mycobacterium tuberculosis [TaxId:83332] [225355] (1 PDB entry)
  8. 2856036Domain d2oqra1: 2oqr A:2-128 [205351]
    Other proteins in same PDB: d2oqra2, d2oqra3
    automated match to d1p2fa2
    complexed with act, bme, la

Details for d2oqra1

PDB Entry: 2oqr (more details), 2.03 Å

PDB Description: the structure of the response regulator regx3 from mycobacterium tuberculosis
PDB Compounds: (A:) Sensory transduction protein regX3

SCOPe Domain Sequences for d2oqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqra1 c.23.1.0 (A:2-128) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpgmsgt
dvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlrrggd
ddsemsd

SCOPe Domain Coordinates for d2oqra1:

Click to download the PDB-style file with coordinates for d2oqra1.
(The format of our PDB-style files is described here.)

Timeline for d2oqra1: