Lineage for d2op4l1 (2op4 L:1-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758513Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)
  8. 1758690Domain d2op4l1: 2op4 L:1-108 [205347]
    Other proteins in same PDB: d2op4l2
    automated match to d1mfbl1
    complexed with edo

Details for d2op4l1

PDB Entry: 2op4 (more details), 2.85 Å

PDB Description: Crystal Structure of Quorum-Quenching Antibody 1G9
PDB Compounds: (L:) Murine Antibody Fab RS2-1G9 Lambda Light Chain

SCOPe Domain Sequences for d2op4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2op4l1 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv
parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgq

SCOPe Domain Coordinates for d2op4l1:

Click to download the PDB-style file with coordinates for d2op4l1.
(The format of our PDB-style files is described here.)

Timeline for d2op4l1: