Lineage for d1b0wc_ (1b0w C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51873Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)
  8. 51876Domain d1b0wc_: 1b0w C: [20534]

Details for d1b0wc_

PDB Entry: 1b0w (more details), 1.8 Å

PDB Description: structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts

SCOP Domain Sequences for d1b0wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0wc_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

SCOP Domain Coordinates for d1b0wc_:

Click to download the PDB-style file with coordinates for d1b0wc_.
(The format of our PDB-style files is described here.)

Timeline for d1b0wc_: