Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries) |
Domain d1b0wc_: 1b0w C: [20534] |
PDB Entry: 1b0w (more details), 1.8 Å
SCOP Domain Sequences for d1b0wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0wc_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)} diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
Timeline for d1b0wc_: