Lineage for d2ongb2 (2ong B:272-599)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282248Species Mentha spicata [TaxId:29719] [225229] (2 PDB entries)
  8. 1282252Domain d2ongb2: 2ong B:272-599 [205336]
    Other proteins in same PDB: d2onga1, d2ongb1
    automated match to d1n1ba2
    complexed with btb, fpg, mn

Details for d2ongb2

PDB Entry: 2ong (more details), 2.7 Å

PDB Description: crystal structure of of limonene synthase with 2-fluorogeranyl diphosphate (fgpp).
PDB Compounds: (B:) 4S-limonene synthase

SCOPe Domain Sequences for d2ongb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ongb2 a.128.1.0 (B:272-599) automated matches {Mentha spicata [TaxId: 29719]}
mnpvvlelaildlnivqaqfqeelkesfrwwrntgfveklpfardrlvecyfwntgiiep
rqhasarimmgkvnalitviddiydvygtleeleqftdlirrwdinsidqlpdymqlcfl
alnnfvddtsydvmkekgvnvipylrqswvdladkymvearwfygghkpsleeylenswq
sisgpcmlthiffrvtdsftketvdslykyhdlvrwssfvlrladdlgtsveevsrgdvp
kslqcymsdynaseaearkhvkwliaevwkkmnaervskdspfgkdfigcavdlgrmaql
myhngdghgtqhpiihqqmtrtlfepfa

SCOPe Domain Coordinates for d2ongb2:

Click to download the PDB-style file with coordinates for d2ongb2.
(The format of our PDB-style files is described here.)

Timeline for d2ongb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ongb1