SCOPe 2.08: Domain d2ongb2: 2ong B:272-599

Lineage for d2ongb2 (2ong B:272-599)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Mentha spicata [TaxId:29719] [225229] (2 PDB entries)

8. Domain d2ongb2: 2ong B:272-599 [205336]
   Other proteins in same PDB: d2onga1, d2ongb1
   automated match to d1n1ba2
   complexed with btb, fpg, mn

Details for d2ongb2

PDB Entry: 2ong, 2.7 Å

PDB Description: crystal structure of of limonene synthase with 2-fluorogeranyl diphosphate (fgpp).

PDB Compounds: (B:) 4S-limonene synthase

SCOPe Domain Sequences for d2ongb2:

Sequence; same for both SEQRES and ATOM records:

>d2ongb2 a.128.1.0 (B:272-599) automated matches {Mentha spicata [TaxId: 29719]}
mnpvvlelaildlnivqaqfqeelkesfrwwrntgfveklpfardrlvecyfwntgiiep
rqhasarimmgkvnalitviddiydvygtleeleqftdlirrwdinsidqlpdymqlcfl
alnnfvddtsydvmkekgvnvipylrqswvdladkymvearwfygghkpsleeylenswq
sisgpcmlthiffrvtdsftketvdslykyhdlvrwssfvlrladdlgtsveevsrgdvp
kslqcymsdynaseaearkhvkwliaevwkkmnaervskdspfgkdfigcavdlgrmaql
myhngdghgtqhpiihqqmtrtlfepfa

Timeline for d2ongb2:

• d2ongb2 first appeared in SCOPe 2.03
  
• d2ongb2 appears in SCOPe 2.07