Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Necator americanus [TaxId:51031] [224893] (3 PDB entries) |
Domain d2on7c1: 2on7 C:1-77 [205328] Other proteins in same PDB: d2on7a2, d2on7b2, d2on7c2, d2on7d2 automated match to d1tw9a2 |
PDB Entry: 2on7 (more details), 2.4 Å
SCOPe Domain Sequences for d2on7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2on7c1 c.47.1.0 (C:1-77) automated matches {Necator americanus [TaxId: 51031]} mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq laqslaicrylarqfgf
Timeline for d2on7c1: