SCOPe 2.06: Domain d2on7b2: 2on7 B:78-206

Lineage for d2on7b2 (2on7 B:78-206)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)

8. Domain d2on7b2: 2on7 B:78-206 [205327]
   Other proteins in same PDB: d2on7a1, d2on7b1, d2on7c1, d2on7d1
   automated match to d1tw9a1

Details for d2on7b2

PDB Entry: 2on7, 2.4 Å

PDB Description: Structure of NaGST-1

PDB Compounds: (B:) Na Glutathione S-transferase 1

SCOPe Domain Sequences for d2on7b2:

Sequence; same for both SEQRES and ATOM records:

>d2on7b2 a.45.1.0 (B:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf

Timeline for d2on7b2:

• d2on7b2 first appeared in SCOPe 2.03
  
• d2on7b2 appears in SCOPe 2.05
  
• d2on7b2 appears in SCOPe 2.07
  
• d2on7b2 appears in the current release, SCOPe 2.08