Lineage for d2on7b2 (2on7 B:78-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714092Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)
  8. 2714103Domain d2on7b2: 2on7 B:78-206 [205327]
    Other proteins in same PDB: d2on7a1, d2on7b1, d2on7c1, d2on7d1
    automated match to d1tw9a1

Details for d2on7b2

PDB Entry: 2on7 (more details), 2.4 Å

PDB Description: Structure of NaGST-1
PDB Compounds: (B:) Na Glutathione S-transferase 1

SCOPe Domain Sequences for d2on7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2on7b2 a.45.1.0 (B:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf

SCOPe Domain Coordinates for d2on7b2:

Click to download the PDB-style file with coordinates for d2on7b2.
(The format of our PDB-style files is described here.)

Timeline for d2on7b2: