SCOPe 2.03: Domain d2on7a1: 2on7 A:1-77

Lineage for d2on7a1 (2on7 A:1-77)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224893] (3 PDB entries)

8. Domain d2on7a1: 2on7 A:1-77 [205324]
   Other proteins in same PDB: d2on7a2, d2on7b2, d2on7c2, d2on7d2
   automated match to d1tw9a2

Details for d2on7a1

PDB Entry: 2on7, 2.4 Å

PDB Description: Structure of NaGST-1

PDB Compounds: (A:) Na Glutathione S-transferase 1

SCOPe Domain Sequences for d2on7a1:

Sequence; same for both SEQRES and ATOM records:

>d2on7a1 c.47.1.0 (A:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
laqslaicrylarqfgf

Timeline for d2on7a1:

• d2on7a1 is new in SCOPe 2.03-stable
  
• d2on7a1 appears in SCOPe 2.04
  
• d2on7a1 appears in the current release, SCOPe 2.08