Lineage for d2on5g1 (2on5 G:1-77)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370640Species Necator americanus [TaxId:51031] [224893] (3 PDB entries)
  8. 1370647Domain d2on5g1: 2on5 G:1-77 [205320]
    Other proteins in same PDB: d2on5a2, d2on5b2, d2on5c2, d2on5d2, d2on5e2, d2on5f2, d2on5g2, d2on5h2
    automated match to d1tw9a2
    complexed with edo, gsh

Details for d2on5g1

PDB Entry: 2on5 (more details), 1.9 Å

PDB Description: Structure of NaGST-2
PDB Compounds: (G:) Na Glutathione S-transferase 2

SCOPe Domain Sequences for d2on5g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2on5g1 c.47.1.0 (G:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfagrglaepirqifalagqkyedvrytfqewpkhkdempfgqipvleedgkq
laqsfaiarylsrkfgf

SCOPe Domain Coordinates for d2on5g1:

Click to download the PDB-style file with coordinates for d2on5g1.
(The format of our PDB-style files is described here.)

Timeline for d2on5g1: