Lineage for d1b0wa_ (1b0w A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653053Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)
  8. 653058Domain d1b0wa_: 1b0w A: [20532]

Details for d1b0wa_

PDB Entry: 1b0w (more details), 1.8 Å

PDB Description: structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
PDB Compounds: (A:) bence-jones kappa I protein bre

SCOP Domain Sequences for d1b0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0wa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

SCOP Domain Coordinates for d1b0wa_:

Click to download the PDB-style file with coordinates for d1b0wa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0wa_: