Lineage for d2on5f2 (2on5 F:78-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714092Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)
  8. 2714098Domain d2on5f2: 2on5 F:78-206 [205319]
    Other proteins in same PDB: d2on5a1, d2on5b1, d2on5c1, d2on5d1, d2on5e1, d2on5f1, d2on5g1, d2on5h1
    automated match to d1tw9a1
    complexed with edo, gsh

Details for d2on5f2

PDB Entry: 2on5 (more details), 1.9 Å

PDB Description: Structure of NaGST-2
PDB Compounds: (F:) Na Glutathione S-transferase 2

SCOPe Domain Sequences for d2on5f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2on5f2 a.45.1.0 (F:78-206) automated matches {Necator americanus [TaxId: 51031]}
agktpfeealvdsvadqykdyineirpylrvvagvdqgdpeklfkelllparekffgfmk
kfleksksgylvgdsvtyadlclaehtsgiaakfpsiydgfpeikahaekvrsipalkkw
ietrpetkf

SCOPe Domain Coordinates for d2on5f2:

Click to download the PDB-style file with coordinates for d2on5f2.
(The format of our PDB-style files is described here.)

Timeline for d2on5f2: