SCOPe 2.06: Domain d2on5f1: 2on5 F:1-77

Lineage for d2on5f1 (2on5 F:1-77)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224893] (6 PDB entries)

8. Domain d2on5f1: 2on5 F:1-77 [205318]
   Other proteins in same PDB: d2on5a2, d2on5b2, d2on5c2, d2on5d2, d2on5e2, d2on5f2, d2on5g2, d2on5h2
   automated match to d1tw9a2
   complexed with edo, gsh

Details for d2on5f1

PDB Entry: 2on5, 1.9 Å

PDB Description: Structure of NaGST-2

PDB Compounds: (F:) Na Glutathione S-transferase 2

SCOPe Domain Sequences for d2on5f1:

Sequence; same for both SEQRES and ATOM records:

>d2on5f1 c.47.1.0 (F:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfagrglaepirqifalagqkyedvrytfqewpkhkdempfgqipvleedgkq
laqsfaiarylsrkfgf

Timeline for d2on5f1:

• d2on5f1 first appeared in SCOPe 2.03
  
• d2on5f1 appears in SCOPe 2.05
  
• d2on5f1 appears in SCOPe 2.07
  
• d2on5f1 appears in the current release, SCOPe 2.08