SCOPe 2.08: Domain d2on5c2: 2on5 C:78-206

Lineage for d2on5c2 (2on5 C:78-206)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)

8. Domain d2on5c2: 2on5 C:78-206 [205313]
   Other proteins in same PDB: d2on5a1, d2on5b1, d2on5c1, d2on5d1, d2on5e1, d2on5f1, d2on5g1, d2on5h1
   automated match to d1tw9a1
   complexed with edo, gsh

Details for d2on5c2

PDB Entry: 2on5, 1.9 Å

PDB Description: Structure of NaGST-2

PDB Compounds: (C:) Na Glutathione S-transferase 2

SCOPe Domain Sequences for d2on5c2:

Sequence; same for both SEQRES and ATOM records:

>d2on5c2 a.45.1.0 (C:78-206) automated matches {Necator americanus [TaxId: 51031]}
agktpfeealvdsvadqykdyineirpylrvvagvdqgdpeklfkelllparekffgfmk
kfleksksgylvgdsvtyadlclaehtsgiaakfpsiydgfpeikahaekvrsipalkkw
ietrpetkf

Timeline for d2on5c2:

• d2on5c2 first appeared in SCOPe 2.03
  
• d2on5c2 appears in SCOPe 2.07