| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d2omnb1: 2omn B:1-112 [205306] Other proteins in same PDB: d2omna2, d2omnb2 automated match to d1aqkl1 complexed with iph, so4 |
PDB Entry: 2omn (more details), 2.2 Å
SCOPe Domain Sequences for d2omnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omnb1 b.1.1.0 (B:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlg
Timeline for d2omnb1: