SCOPe 2.05: Domain d2omda_: 2omd A:

Lineage for d2omda_ (2omd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.0: automated matches [191646] (1 protein)
   not a true family

6. Protein automated matches [191185] (4 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [225400] (1 PDB entry)

8. Domain d2omda_: 2omd A: [205302]
   automated match to d2wp4b_
   complexed with cl, fmt, gol, na, trs

Details for d2omda_

PDB Entry: 2omd, 2 Å

PDB Description: Crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus VF5

PDB Compounds: (A:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d2omda_:

Sequence; same for both SEQRES and ATOM records:

>d2omda_ d.41.5.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mevgmiprvylghewfgaerilseyqvpedcgaqvlflgiprnapedggniealeyeayp
emaikemekirqetiekfgvkevfihhrlglvkigepsflvlavgghreetfkacryavd
etkkrvpiwkkeifk

Timeline for d2omda_:

• d2omda_ first appeared in SCOPe 2.03
  
• d2omda_ appears in SCOPe 2.04
  
• d2omda_ appears in SCOPe 2.06
  
• d2omda_ appears in the current release, SCOPe 2.08