SCOPe 2.06: Domain d2ombd2: 2omb D:113-217

Lineage for d2ombd2 (2omb D:113-217)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
Domain d2ombd2: 2omb D:113-217 [205301]
Other proteins in same PDB: d2omba1, d2ombb1, d2ombc1, d2ombd1
automated match to d1aqkl2
complexed with iph, so4

Details for d2ombd2

PDB Entry: 2omb (more details), 2.9 Å

PDB Description: bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form

PDB Compounds: (D:) Bence Jones KWR Protein - Immunoglobulin Light Chain

SCOPe Domain Sequences for d2ombd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ombd2 b.1.1.2 (D:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d2ombd2:

Click to download the PDB-style file with coordinates for d2ombd2.
(The format of our PDB-style files is described here.)

Timeline for d2ombd2: